2. Cardiovascular Disease

Cardiovascular Disease

Cardiovascular Disease

Related Products

PDF 32.36 MB

Cardiovascular diseases (CVDs) are the leading causes of death and disability worldwide. CVDs include diseases of the heart, vascular diseases of the brain and diseases of blood vessels. Caused by atherosclerosis, coronary heart disease and cerebrovascular disease are the most common forms of CVDs. Other less common forms of CVDs include rheumatic heart disease and congenital heart disease. A large percentage of CVDs is preventable through the reduction of behavioral risk factors such as tobacco use, physical inactivity and unhealthy diet. Dietary sodium reduction can alleviate the long-term risk of cardiovascular disease events. Statin therapy is an effective intervention in both the primary and secondary preventions of CVDs in those who are at high risk.

Cat. No. Product Name CAS No. Purity Chemical Structure
  • HY-P3142
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.
    NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ
  • HY-P3436
    WLSEAGPVVTVRALRGTGSW 771479-86-8
    WLSEAGPVVTVRALRGTGSW is a cardiomyocyte specific peptide. WLSEAGPVVTVRALRGTGSW-expressing exosomes can improve specific uptake by cardiomyocytes, decrease cardiomyocyte apoptosis, and enhance cardiac retention following intramyocardial injection in vivo.
    WLSEAGPVVTVRALRGTGSW
  • HY-P3460
    TDSRCVIGLYHPPLQVY 887973-01-5 98%
    TDSRCVIGLYHPPLQVY is a disordered control peptide. TDSRCVIGLYHPPLQVY is a peptide containing the same amino acids as LP17 (HY-P3400) but in a different sequence order.
    TDSRCVIGLYHPPLQVY
  • HY-P3533
    EILEVPST 239075-62-8 98.99%
    EILEVPST is a recombinant human fibronectinderived low-molecular-weight peptide fragment. EILEVPST can promote cell type-specific α4 integrin-mediated adhesion. EILEVPST can be used for the research of thrombogenesis.
    EILEVPST
  • HY-P3678
    Neuropeptide Y (18-36) (porcine) 114495-97-5 98.76%
    Neuropeptide Y (18-36) (porcine) is a competitive neuropeptide Y (NPY) cardiac receptor antagonist. Neuropeptide Y (18-36) (porcine) inhibits the binding of I-NPY to cardiac ventricular membranes in a concentration-dependent manner with an IC50 value of 158 nM and an Ki value of 140 nM. Neuropeptide Y (18-36) (porcine) can be used for the research of congestive heart failure.
    Neuropeptide Y (18-36) (porcine)
  • HY-P3769
    Prepro-ANF (56-92), human 112199-06-1 99.93%
    Prepro-ANF (56-92), human is a human atrial natriuretic factor precursor. Prepro-ANF (56-92), human is also a guanylate cyclase activator that enhances particulate guanylate cyclase activity in the renal membrane and renal unit.
    Prepro-ANF (56-92), human
  • HY-P4469
    PRL 3195 341519-04-8 98%
    PRL 3195 is a somatostatin receptor antagonist with Kis of 6, 17, 66, 1000 and 1000 nM for human somatostatin receptors (sst5, sst2, sst3, sst1 and sst4, respectively).
    PRL 3195
  • HY-P4683
    (Phenylac1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin 129520-65-6 98%
    (Phenylac1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin is a potent vasopressin V1 receptor (VP V1R) antagonist. (Phenylac1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin significantly decreases the mean arterial pressure (MAP) in rats.
    (Phenylac1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin
  • HY-100119
    Enecadin 259525-01-4 99.71%
    Enecadin is a neuroprotective agent extracted from patent US 8623823 B2.
    Enecadin
  • HY-100240
    Lodelaben 111149-90-7
    Lodelaben is a human neutrophil elastase inhibitor with an IC50 and Ki of 0.5 and 1.5 μM, respectively.
    Lodelaben
  • HY-100300
    AGN 192836 171102-29-7 ≥98.0%
    AGN 192836 is a potent and selective α2 adrenergic agonist with EC50s of 8.7, 41 and 6.6 nM for α2A, α2B and α2C receptor, respectively.
    AGN 192836
  • HY-100572
    Nicainoprol 76252-06-7 99.86%
    Nicainoprol is a fast-sodium-channel blocking agent, which is a potent antiarrhythmic agent.
    Nicainoprol
  • HY-100635
    Diacetolol 22568-64-5
    Diacetolol is an active metabolite of the beta-adrenoceptor blocking agent Acebutolol (HY-17497).
    Diacetolol
  • HY-100662
    Didesethyl chloroquine 4298-14-0 99.91%
    Didesethyl chloroquine (Bisdesethylchloroquine) is a major metabolite of the antimalarial agent Chloroquine. Didesethyl chloroquine is a potent myocardial depressant.
    Didesethyl chloroquine
  • HY-100718
    SCH00013 217963-18-3 98%
    SCH00013 is a cardiotonic that primarily increases the sensitivity of muscle fibers to Ca++.
    SCH00013
  • HY-100826
    TN1 289479-94-3
    TN1 is a potent fetal hemoglobin (HbF) inducer.
    TN1
  • HY-101245
    Pilsicainide hydrochloride 88069-49-2 99.94%
    Pilsicainide hydrochloride (SUN-1165) is an orally active sodium channel blocker and potent class Ic antiarrhythmic agent.
    Pilsicainide hydrochloride
  • HY-101308
    MRS2179 tetrasodium 1454889-37-2 98%
    MRS2179 tetrasodium is a competitive P2Y1 receptor antagonist, with a Kb of 102 nM and a pA2 of 6.99 for turkey P2Y1 receptor. MRS2179 tetrasodium is selective for P2Y1 over P2X1 (IC50=1.15 µM), P2X3 (12.9 µM), P2X2, P2X4, P2Y2, P2Y4, and P2Y6 receptors. MRS2179 tetrasodium inhibits platelet aggregation.
    MRS2179 tetrasodium
  • HY-101327
    Xamoterol 81801-12-9 98%
    Xamoterol is a selective and potent agonist of beta1-adrenergic receptor. Xamoterol has the potential for the research of arrhythmogenesis. Xamoterol has the potential for the investigating the relationship between β1-adrenergic stimulation and IKr.
    Xamoterol
  • HY-101554
    Guancydine 1113-10-6 ≥98.0%
    Guancydine (Guancidine) is an antihypertensive agent.
    Guancydine
Cat. No. Product Name / Synonyms Application Reactivity